PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi5g20051.1.p
Common NameBRADI_5g20051, LOC100831814
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MYB
Protein Properties Length: 345aa    MW: 37638.3 Da    PI: 6.621
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi5g20051.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.41.8e-141564148
                      TSSS-HHHHHHHHHHHHHTTTT..-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg..tWktIartmgkgRtlkqcksrwqkyl 48
                      +g+WT+eEd+ lv+ +++ Gg+  +W+  ++  g++R++k+c++rw +yl
  Bradi5g20051.1.p 15 KGPWTEEEDKTLVEHIQKRGGHvgSWRGLPKAAGLNRCGKSCRLRWTNYL 64
                      79**********************************************97 PP

2Myb_DNA-binding52.11.5e-1670114147
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       rg++T +++ l+v+++++lG++ W+tIa ++  gRt++++k++w+++
  Bradi5g20051.1.p  70 RGNFTDDDERLIVRLHALLGNK-WSTIATHLE-GRTDNEIKNYWNTH 114
                       89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.1E-20767IPR009057Homeodomain-like
PROSITE profilePS5129414.7051064IPR017930Myb domain
SuperFamilySSF466895.24E-2712111IPR009057Homeodomain-like
SMARTSM007171.0E-81466IPR001005SANT/Myb domain
PfamPF002493.8E-131564IPR001005SANT/Myb domain
CDDcd001671.36E-71764No hitNo description
PROSITE profilePS5129426.31465119IPR017930Myb domain
Gene3DG3DSA:1.10.10.608.6E-2568119IPR009057Homeodomain-like
SMARTSM007173.8E-1569117IPR001005SANT/Myb domain
PfamPF002492.4E-1470114IPR001005SANT/Myb domain
CDDcd001673.01E-1172115No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 345 aa     Download sequence    Send to blast
MGRSPCCCHE AGVKKGPWTE EEDKTLVEHI QKRGGHVGSW RGLPKAAGLN RCGKSCRLRW  60
TNYLRPDIKR GNFTDDDERL IVRLHALLGN KWSTIATHLE GRTDNEIKNY WNTHIRKKLL  120
RMGVDPVTHQ QLPPEHQHHR SNQHLPEPLL WAAAAASLGG QLDTGLIMQA QLLQQLLQAI  180
GSSSNNNTNS TSSFVANLAA GAANAMLGSS ASIVPNLLLQ DQTMGLLSGS ANYLQPGYLG  240
NMSNFAEQDV VQQQLINAAT STMARDGTSS SAAAEPAGHH QQQQHCGTAV AFVSDDAVAP  300
ALERPPVVQE FADLLEPMEQ LPNLCSLESD SFWKDILEDS YRLC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-26151197108B-MYB
1h8a_C1e-261511927128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2432711e-135AK243271.1 Oryza sativa Japonica Group cDNA, clone: J100049K04, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003581590.20.0PREDICTED: transcription factor MYB39
TrEMBLA0A0Q3P5X80.0A0A0Q3P5X8_BRADI; Uncharacterized protein
STRINGBRADI5G20050.11e-159(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62652955
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16770.24e-70myb domain protein 9